Bacterial taxon 373153
Protein WP_000738307.1
CPBP family intramembrane metalloprotease
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP35
>WP_000738307.1|Streptococcus pneumoniae D39|CPBP family intramembrane metalloprotease
MKKMKEVKFHLATGLLILTYYLIFNVTSDLDFMVALSDNMYYVFQVLLVLILGTIATIAFVKSEHWKECGRFQFRWSYLGVFLLSFFLLFVWANLTTYIFPRTQNGSTVVEVATSLTGISYFVTRILYTSIIAPVSEEVVCRGLLMTSLSKVNRYYLDVLVSAAIFGAMHVLQYGWITTDFIKYFGMGLIFCMMFRYTRSIYWAIALHASWNSFLLIVTLLVFGY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● 6 | 5.9980733747097 | 1.4e-267 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●● 5.39 | 5.39015178506096 | 4.6e-216 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.68 | 0.6822719827226 | 0.00012 | 27678244 | |
Retrieved 3 of 1 entries in 1.9 ms
(Link to these results)