Bacterial taxon 373153
Protein WP_000638785.1
copper homeostasis protein CutC
Streptococcus pneumoniae D39
Gene cutC, UniProt A0A0H2ZQU4
>WP_000638785.1|Streptococcus pneumoniae D39|copper homeostasis protein CutC
MIYEFCAENVTLLEKAMQAGARRIELCDNLAVGGTTPSYGVTKAAVELAANYDTTIMTMIRPRGGDFVYNDLEIAIMLEDIRLTAQAGSQGVVFGALTADKKLDKPNLEKLIAASKGMEIVFHMAFDELSDEDQPEAIDWLSQAGVTRILTRAGVSGDSLEKRFVHYHRILEYAKGKIEILPGGGIDLDNRQIFIDQVGVTQLHGTKVVF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.65 | 0.653560503225655 | 3.2e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.59 | 0.58704741178629 | 0.00021 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.32 | 0.32418044755404 | 0.044 | 27678244 | |
Retrieved 3 of 1 entries in 0.5 ms
(Link to these results)