Bacterial taxon 373153
Protein WP_000153023.1
Cof-type HAD-IIB family hydrolase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZR64
>WP_000153023.1|Streptococcus pneumoniae D39|Cof-type HAD-IIB family hydrolase
MTIKLVATDMDGTFLDGNGRFDMDRLKSLLASYKEKGIYFAVASGRGFLSLEKLFADVRDDIIFIAENGSLVEYQGQDLYEATMSRDFYLATFEKLKTSPYVDINKLLLTGKKGSYVLDTVDETYLKVSQHYNENIQKVASLEDITDDIFKFTTNFTEETLEAGEAWVNEHVPGVKAMTTGFESIDIVLDYVDKGVAIVELAKKLGITMDQVMAFGDNLNDLHMMQVVGHPVAPENARPEILELAKTVIGHHKERSVIAYMEGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.5 | -1.50228564436848 | 1.2e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.07 | -1.06724648656344 | 6.2e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.55 | -0.547445704193046 | 0.024 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)