Bacterial taxon 373153
Protein WP_000763459.1
Cof-type HAD-IIB family hydrolase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLM0
>WP_000763459.1|Streptococcus pneumoniae D39|Cof-type HAD-IIB family hydrolase
MADIKLIALDLDGTLLTTDKRLTDRTKETLKAARDRGIKVVLTTGRPLKAMDFFLHELGTDGQEDEYTITFNGGLVQKNTGEILDKTVFSYDDVARLYEETEKLSLPLDAISEGTVYQIQSDQESLYAKFNPALTFVPVDFEDLSSQMTYNKCVTAFAQEPLDAAIQKISPELFDQYEIFKSREMLLEWSPKNVHKATGLAKLISHLGIDQSQVMACGDEANDLSMIEWAGLGVAMQNAVPEVKAAANVVTPMTNDEEAVAWAIEEYVLKEN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.71 | -1.7098855421504 | 1.1e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.31 | -1.31197765211972 | 2.5e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.75 | -0.750036025948753 | 0.0038 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)