Bacterial taxon 373153
Protein WP_001287230.1
class I SAM-dependent methyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRM9
>WP_001287230.1|Streptococcus pneumoniae D39|class I SAM-dependent methyltransferase
MSEAGHKFLAKLGKKRLRPGGKRATDWLIAEGGFSKEKRILEVACNRGTTAIELAQRFGCKITAVDMDAQALEVAKKSAGTAGVAHLISFERANAMKLPYQDASFDIVINEAMLTMQADQAKKKCVMEYLRVLKPGGLLLTHDVLLKEAKESIRQELSQAIHVNVGPLTQDGWEQVMIESGYCDVKALTGEMTLMKLSGMIYDEGLLGTLKICVNACKKENRKQFLTMYKMFAKNKQKLGFIAMASYKSSKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.8 | 1.79897985969413 | 1.2e-35 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.76 | 1.75900906082638 | 2.3e-34 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.66 | 1.65963329017334 | 1.4e-30 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)