Bacterial taxon 373153
Protein WP_000867305.1
chromosome partitioning protein ParB
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRY4
>WP_000867305.1|Streptococcus pneumoniae D39|chromosome partitioning protein ParB
MKVNIADLHPTQLYLSEKKLQDIQMLYQSAETNQVDPISILAFGDCLLITDGHHRAYQALLAGRDTISAEWDRDGGDELYHLYAQACEERKIYSVFDLEDRILAQDGYEAKWYNWCDGFNQAATLLLKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.2 | -1.20441134365178 | 2.4e-20 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.93 | -0.929206425274442 | 9.4e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.92 | -0.91950874788997 | 1.1e-12 | 27678244 | |
Retrieved 3 of 1 entries in 1.8 ms
(Link to these results)