Bacterial taxon 373153
Protein WP_000362440.1
chorismate mutase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPA2
>WP_000362440.1|Streptococcus pneumoniae D39|chorismate mutase
MDLDIIRQEIDQIDDQIVKLLEERMHLVEGVVAYKKASGKPILDTKREEVIFEKVRSRVEDKRYQETIVATFSDILKRSRDYQDQNIK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.71 | 2.70676568599558 | 1.1e-53 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.67 | 2.66899647067145 | 5.8e-52 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.35 | 2.3472408024262 | 2.0e-40 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)