Bacterial taxon 373153
Protein WP_000291826.1
cell wall-binding protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZM16
>WP_000291826.1|Streptococcus pneumoniae D39|cell wall-binding protein
MYYSVDDVVSNAFKKRMILDSFFAFNCSGTMKVSTWVYDKGEWYYVSSSGSMIANDWVKDNGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.34 | 2.3402580307322 | 8.2e-33 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.24 | 2.23790788154206 | 2.5e-30 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.38 | 1.38240071260453 | 3.4e-12 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)