Bacterial taxon 373153
Protein WP_000818547.1
cell division protein FtsL
Streptococcus pneumoniae D39
Gene ftsL, UniProt A0A0H2ZP65
>WP_000818547.1|Streptococcus pneumoniae D39|cell division protein FtsL
MAEKMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQTKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.45 | -0.45154035237958 | 0.00035 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.4 | -0.401758830728805 | 0.0017 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.28 | -0.280286555662884 | 0.031 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)