Host taxon 9606
Protein NP_001304272.1
CDKN2A-interacting protein isoform 2
Homo sapiens
Gene CDKN2AIP, UniProt Q9NXV6
>NP_001304272.1|Streptococcus pneumoniae D39|CDKN2A-interacting protein isoform 2
MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKKG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.1 | -1.10434914817043 | 1.0e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.75 | -0.751532783542333 | 0.0013 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.66 | 0.663638180843106 | 0.0004 | 27678244 | |
Retrieved 3 of 2 entries in 1.4 ms
(Link to these results)