Bacterial taxon 373153
Protein WP_000268654.1
CBS domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPI9
>WP_000268654.1|Streptococcus pneumoniae D39|CBS domain-containing protein
MAVKDFMTRKVVYISPDTTVSHAADLMREQELHRLPVIENDQLVGLVTEGTIAQASPSKATSLSIYEMNYLLNKTKVKDVMIRDVVTVSGYASLEDATYLMLKNKIGILPVVDNHQVYGVITDRDVFQAFLEIAGYGEEGIRVRFVTEDEVGVLGKIVSLIVEENLNISHTVNIPRKDGKVIIEVQIDGSIDLPALKEKFEANGIQVEEIVRTSAKVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.34 | 2.34128855368713 | 1.2e-65 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.92 | 1.91553275137173 | 6.3e-44 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.85 | 1.85345083391565 | 4.7e-41 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)