Bacterial taxon 373153
Protein WP_000664148.1
capsular polysaccharide biosynthesis protein CpsC
Streptococcus pneumoniae D39
Gene cps2C, UniProt Q9ZII7
>WP_000664148.1|Streptococcus pneumoniae D39|capsular polysaccharide biosynthesis protein CpsC
MKEQNTIEIDVFQLFKTLWKRKLMILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKSGLTNQDLQAGSYLVKDYREIILSQDALEKVATNLKLDMPAKTLASKVQVTVPTDTRIVSISVKDKQPEEASRIANSLREVAVEKIVAVTRVSDVTTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELFDTRVKRPEDIEDVLQIPLLGLVPDLDKMK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.97 | -0.970289328560133 | 6.1e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.85 | -0.849762349042062 | 3.5e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.82 | -0.822400160405135 | 8.7e-7 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)