Bacterial taxon 373153
Protein WP_000709036.1
biotin transporter BioY
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLZ7
>WP_000709036.1|Streptococcus pneumoniae D39|biotin transporter BioY
MKKAHVYAIPAIGAALIAVLAQISLPIGPVPFTLQNFAIGLIATVFRPREAVLSAGLYLLLGAIGLPVFAGGGAGFQALVGPTAGYLWFYLVYSGLTSSLTNSKSGVVKIFLANLLGDALVFVGGILSLHFLAGMAFEKALVVGVLPFIIPDLGKLLAISFISRPLLQRLKNQAYFTN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● -4.17 | -4.1672237664695 | 7.6e-81 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ -3.78 | -3.77869614463305 | 2.5e-67 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ -3.69 | -3.69456973599861 | 6.5e-65 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)