Bacterial taxon 373153
Protein WP_000078816.1
bacteriocin-associated integral membrane family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQ16
>WP_000078816.1|Streptococcus pneumoniae D39|bacteriocin-associated integral membrane family protein
MSQKMNHLDVGEFVLLLPEHLRSEEEHYKSVFEDDLTSRISSQDERQQMTATVGYLESGQDRFVYNTTPISYQQFLKDPIIIVITPQSTGPQSILFWIDAVQNYVLFNQLSDAQELIQRQGIENWVSEMQTGYHNYITLLDNIQRERWVMLAGAVLGIATSILLFNTMNRLYFEEFRRAIFIKRIAGLRFLEIHRTYLFAQLGVFLLGFVASVFLQVEIGVAFLVLLLFTGLSLLQLHVQMQKENKMSMLVLKGG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.74 | 1.74006366016839 | 4.1e-38 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.64 | 1.63587016495031 | 5.5e-34 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.42 | 1.4153654511695 | 6.2e-26 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)