Bacterial taxon 373153
Protein WP_000985093.1
bacteriocin immunity protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZME9
>WP_000985093.1|Streptococcus pneumoniae D39|bacteriocin immunity protein
MMRNEFRERVEQLLQQKEINENSELSHLFRLAIQNLDRNEKYQTVMANLSQGLSLYLMTHHYQAPKSVIDFGLWIAKAPSQERGRLAFLQMLAQTLQGFR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.71 | -0.712360129334862 | 6.8e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.45 | -0.454817552693735 | 5.1e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.41 | -0.405220957524451 | 4.4e-5 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)