Bacterial taxon 373153
Protein WP_001034414.1
arginine repressor
Streptococcus pneumoniae D39
Gene argR, UniProt A0A0H2ZLV7
>WP_001034414.1|Streptococcus pneumoniae D39|arginine repressor
MNKKERLEKIRRLVTDYQIGTQEEIVEHLKEAGITATQATVSRDIKELGIVKIPLRDNTYVYELPKSIVKSLQLAEDNIESAELMDKMINLQVIPGNTAFVKAQLIETFADKIFSCLTDDGSILVIARSGSLAEEIFEQVKNW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.17 | -1.17259664525759 | 1.2e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.71 | -0.712753310739638 | 0.0016 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.59 | -0.589283854252561 | 0.0095 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)