Bacterial taxon 373153
Protein WP_001042996.1
arginine repressor
Streptococcus pneumoniae D39
Gene argR, UniProt A0A0H2ZPQ5
>WP_001042996.1|Streptococcus pneumoniae D39|arginine repressor
MNKSEHRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSAYYVLNNGSISKWEKRLELYMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQKCFEELKKFAPPFFFEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.13 | 1.13324929561508 | 4.4e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.86 | 0.857239583568739 | 3.5e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.82 | 0.815546304690632 | 0.00013 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)