Bacterial taxon 373153
Protein WP_000959952.1
AraC family transcriptional regulator
Streptococcus pneumoniae D39
Gene msmR, UniProt A0A0H2ZQ45
>WP_000959952.1|Streptococcus pneumoniae D39|AraC family transcriptional regulator
MLVFSEYQTGTIDLALSFYGYEECTPNYSFGPAIRDTYVLHYISKGQGKFHYKGKIVDLKEGDFFLLKPEELTFYQADSKEPWAYYWLGITGGKSPDYFALSQISDQSYLIQSETCHTQTTAKLISDIVRFAQITKSSELAQLHIMGQLHELMFHLGTIAPNQKKKNISSTHQLYLECKRLIDSHYPQSLTIQDLAKELSVHRSYLSSVFKEFNTLSPKEYLLYVRMHRARQLLENTQESIKVIAYSVGFSDPLHFSKAYKQYFNQSPSHTRKEYSQYQLVRKATL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.03 | 2.03370644658041 | 5.1e-12 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.61 | 1.60596679202769 | 6.5e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.47 | 1.47287465650049 | 6.7e-7 | 27678244 | |
Retrieved 3 of 1 entries in 0.5 ms
(Link to these results)