Bacterial taxon 373153
Protein WP_001064217.1
anaerobic ribonucleoside-triphosphate reductase activating protein
Streptococcus pneumoniae D39
Gene nrdG, UniProt A0A0H2ZPT0
>WP_001064217.1|Streptococcus pneumoniae D39|anaerobic ribonucleoside-triphosphate reductase activating protein
MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVSGCMFHCEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRIRKELPDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQRIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.22 | 2.22204161856425 | 8.8e-16 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.83 | 1.83466712386568 | 4.1e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.77 | 1.77211931483728 | 2.1e-10 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)