Bacterial taxon 373153
Protein WP_000601926.1
aminodeoxychorismate/anthranilate synthase component II
Streptococcus pneumoniae D39
Gene trpG, UniProt A0A0H2ZMY6
>WP_000601926.1|Streptococcus pneumoniae D39|aminodeoxychorismate/anthranilate synthase component II
MILLIDNYDSFTYNLAQYIGNFAEVQVLRNDDSKLYEEAEKADGLVFSPGPGWPVDAGKMEDMIRDFAGKKPILGICLGHQAIAEVFGGKLGLAPKVMHGKQSNINFEAPSVLYQGIEDGRAVMRYHSILIEEMPEDFEVTARSTDDQAIMGIQHKNLPIYGFQYHPESIGTPDGLSSIRNFIEEVVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.21 | 1.2134872386096 | 3.1e-20 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.83 | 0.827836150874364 | 6.8e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.3 | 0.302883452987286 | 0.027 | 27678244 | |
Retrieved 3 of 1 entries in 0.3 ms
(Link to these results)