Bacterial taxon 373153
Protein WP_001085888.1
aminoacyl-tRNA deacylase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNK1
>WP_001085888.1|Streptococcus pneumoniae D39|aminoacyl-tRNA deacylase
MAKKVKIKKTLVEQILSKAAIPHQGIQINALEGELPQGYERDQIFKTLALLGDKTGPIIGIVPITQHLSEKKLAKISGNKKVSMIPQKDLEKTTGYIHGANNPVGIRQKHNYPIFIDKIALDLDRMIVSAGEVGHSIIVAPQDLASFVKADFVDILEDIK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.94 | 0.9426512468517 | 9.2e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.64 | 0.641103888193555 | 2.2e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.58 | 0.584652741059751 | 2.6e-6 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)