Bacterial taxon 373153
Protein WP_000131158.1
amino acid ABC transporter permease
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMP7
>WP_000131158.1|Streptococcus pneumoniae D39|amino acid ABC transporter permease
MTDLSSWTAYFQDFGQFFNGFLFTLALAVGSFILAMVLGIFFGAMSTSKRPILRILARIFVEFYQNTPLLVQFVIVFYGLPLISDHIIMIPIYWTAVLCVGLYHGAYIAEVIRSGIQSIPSGQMEAALSQGFTYISAMRLIILPQAFRIILPPLTNQIVNLIKNTSTVAIISGVDLMFVTKSWSALNGNYIPAFLGAALLYFALCFPVAQFGRKMEQANKKAYSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.6 | 1.59574866606642 | 9.7e-35 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.86 | 0.859205934377166 | 2.4e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.82 | 0.819169210009903 | 1.0e-9 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)