Bacterial taxon 373153
Protein WP_000891772.1
amino acid ABC transporter ATP-binding protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP26
>WP_000891772.1|Streptococcus pneumoniae D39|amino acid ABC transporter ATP-binding protein
MLELRNINKVFGDKQILSNFSLSIPEKQILAIVGPSGGGKTTLLRMLAGLETIDSGQIFYNGQPLELDELQKRNLLGFVFQDFQLFPHLSVLENLTLSPVKTMGMKQEEAEKKASGLLEQLGLGGHAEAYPFSLSGGQKQRVALARAMMIDPEIIGYDEPTSALDPELRLEVEKLILQNRELGMTQIVVTHDLQFAENIADVLLKVEPK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.55 | 2.55098422777448 | 2.7e-133 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.55 | 2.54637925423518 | 1.3e-132 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.45 | 2.44679982422934 | 1.6e-122 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)