Bacterial taxon 373153
Protein WP_000590970.1
amino acid ABC transporter ATP-binding protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQE6
>WP_000590970.1|Streptococcus pneumoniae D39|amino acid ABC transporter ATP-binding protein
MIKISNLSKSFSGQTVLDHLDLDIQKGEVVALIGSSGAGKSTFLRSLNYLETPDSGSIQIDGFSVDFSKITQEEILALRRKLSMVFQQFNLFERRTALDNVKEGLVVVKKLSDQEATKIAKEELAKVGLSDRENHYPRHLSGGQKQRVALARALAMKPDVLLLDEPTSALDPELVGEVEKSIADAAKSGQTMILVSHDMSFVAQVADKILFLDKGKIIESGTPDEIIHTPKEERTKEFFASYKRTYI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.11 | 1.10647042990681 | 4.0e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.76 | 0.764482561208129 | 6.4e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.65 | 0.652830516399279 | 0.00065 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)