Bacterial taxon 373153
Protein WP_001096316.1
amino acid ABC transporter ATP-binding protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPL5
>WP_001096316.1|Streptococcus pneumoniae D39|amino acid ABC transporter ATP-binding protein
MAKLKIDVNDLHKHYGKNEVLKGITTKFYEGDVVCIIGPSGSGKSTFLRSLNLLEEVTSGHITVNGYDLTEKTTNVDHVRENIGMVFQHFNLFPHMSVLDNITFAPIEHKLMTKEEAEKLGMELLEKVGLADKANANPDSLSGGQKQRVAIARGLAMNPDIMLFDEPTSALDPEMVGDVLNVMKELAEQGMTMIIVTHEMGFARQVANRVIFTADGEFLEDGTPDQIFDNPQHPRLKEFLDKVLNV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.18 | -2.18200615064076 | 5.0e-47 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.99 | -1.99009408954171 | 2.2e-39 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.54 | -1.53935555411131 | 3.5e-24 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)