Host taxon 9606
Protein NP_008913.2
ALX homeobox protein 1
Homo sapiens
Gene ALX1, UniProt Q15699
>NP_008913.2|Streptococcus pneumoniae D39|ALX homeobox protein 1
MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.48 | -1.48168377017631 | 7.0e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.36 | -1.35675414916665 | 2.4e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.72 | -0.718007775575142 | 0.023 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)