Bacterial taxon 373153
Protein WP_000030209.1
alkaline shock response membrane anchor protein AmaP
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMQ5
>WP_000030209.1|Streptococcus pneumoniae D39|alkaline shock response membrane anchor protein AmaP
MSKAKKICFIIFCILILTIFLPVLIDYHQVSDLGIHLLSWRQHSVVEFYLARYVFWGTVVLSTLVLLSILVVMFYPKRYLEIQLETKNDTLKLKNSAIEGFVRSLVSDHRLIKNPTVHVNLRKNKCFVHVEGKILPSDNIADRCQIIQNEITNGLKQFFGIERQVKLEVAVKNYQPKPQNKKTVSRVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.86 | -2.85515594916961 | 7.8e-99 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.31 | -2.30834882931116 | 1.5e-65 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.41 | -0.408019092635063 | 0.0034 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)