Bacterial taxon 373153
Protein WP_000782664.1
adaptor protein MecA
Streptococcus pneumoniae D39
Gene mecA, UniProt Q04JY5
>WP_000782664.1|Streptococcus pneumoniae D39|adaptor protein MecA
MKMKQISDTTLKITISLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDKVDVFVTKSKIDQNLDFEDLSDLPDMEELAQMSPDEFIKTLEKSIADKTKDDIEAIQSLEQVEAKEEEQEQAEQEAESKKEPYIYYILSFAKLADLVAFAKTVTFEMETSELYKMNERYYLTILVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVLNLQKIG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.45 | 0.450069334407862 | 2.8e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.41 | 0.40982093828269 | 2.2e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.4 | 0.396212507820047 | 4.5e-5 | 27678244 | |
Retrieved 3 of 1 entries in 2.2 ms
(Link to these results)