Bacterial taxon 373153
Protein WP_000644124.1
ACT domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQA5
>WP_000644124.1|Streptococcus pneumoniae D39|ACT domain-containing protein
MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAMYNI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.6 | 2.60043978927648 | 9.9e-53 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.11 | 2.11144012497587 | 4.8e-35 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.04 | 2.03605013746287 | 1.3e-32 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)