Bacterial taxon 373153
Protein WP_001052244.1
acetyl-CoA carboxylase biotin carboxyl carrier protein
Streptococcus pneumoniae D39
Gene accB, UniProt A0A0H2ZN18
>WP_001052244.1|Streptococcus pneumoniae D39|acetyl-CoA carboxylase biotin carboxyl carrier protein
MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVATQVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVATEGNLVESPLVGVVYLAAGPDKPAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ -3.05 | -3.04545489683794 | 5.8e-29 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.63 | -2.62657905669096 | 7.7e-22 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.06 | -2.06043308056627 | 5.2e-14 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)