Bacterial taxon 373153
Protein WP_000919280.1
ABC transporter permease
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMU6
>WP_000919280.1|Streptococcus pneumoniae D39|ABC transporter permease
MLKRFLALVWLRCQIILSNKSILLQVLVPFAFTYFYKYLMETQGKVNDQQALVLLMMCLPFSLALAVGSPITIILSEEKEKYNLQTLLLSGVKGSEYILSTMFLPFLLTFVIMGTTPLILGVTIVHTFNYITIVLLTSLSIILFYLLIGLTAKSQVVAQVISLPAMILVAFLPMLSSLDKTVAKITDYSFMGLFTKFFTKWEGFSWNETLIPNLTLLIWIVLLLTLITITIRKKKIS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.52 | -1.51966498593314 | 7.9e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.46 | -1.46275562807762 | 4.4e-16 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.97 | -0.969675417283239 | 1.0e-7 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)