Bacterial taxon 373153
Protein WP_001135782.1
8-oxo-dGTP diphosphatase
Streptococcus pneumoniae D39
Gene mutX, UniProt A0A0H2ZN52
>WP_001135782.1|Streptococcus pneumoniae D39|8-oxo-dGTP diphosphatase
MPQLATICYIDNGKELLMLHRNKKPNDVHEGKWIGVGGKLERGETPQECAVREILEETGLKAKPVLKGVITFPEFTPDLDWYTYVFKVTEFEGDLIDCNEGMLEWVPYDEVLSKPTWEGDHTFVEWLLEDKPFFSAKFVYDGDKLLDTQVDFYE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.67 | 0.667660275948423 | 1.0e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.61 | 0.612913885236811 | 4.7e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.56 | 0.56424720805953 | 0.00022 | 27678244 | |
Retrieved 3 of 1 entries in 0.4 ms
(Link to these results)