Bacterial taxon 373153
Protein WP_001861299.1
8-oxo-dGTP diphosphatase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLR1
>WP_001861299.1|Streptococcus pneumoniae D39|8-oxo-dGTP diphosphatase
MNRREAVEFVNMCMIKNGDKILVQDRVSPDWPGITFPGGHVERGESFVDAVIREVKEETGLIISKPQLCGIKNWYDDKDYRYVVLFYKTEHFTGELQSSDEGKVWWEDFENLSHLKLATDDMSDMLRVFLEEDLSEFFYYKNGDDWLYDLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.06 | -1.05567825157271 | 3.4e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.06 | -1.05518024494971 | 2.0e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.82 | -0.822389630009882 | 1.6e-12 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)