Bacterial taxon 373153
Protein WP_001099502.1
6,7-dimethyl-8-ribityllumazine synthase
Streptococcus pneumoniae D39
Gene ribH, UniProt Q04MR3
>WP_001099502.1|Streptococcus pneumoniae D39|6,7-dimethyl-8-ribityllumazine synthase
MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNEKDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQISLNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.44 | 1.43651220328395 | 4.5e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.88 | 0.876578294790578 | 1.0e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.53 | 0.526646687451986 | 0.0019 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)