Bacterial taxon 373153
Protein WP_001196960.1
50S ribosomal protein L7/L12
Streptococcus pneumoniae D39
Gene rplL, UniProt Q04JZ4
>WP_001196960.1|Streptococcus pneumoniae D39|50S ribosomal protein L7/L12
MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAVAAADAADAGAAKDSFDVELTSAGDKKVGVIKVVREITGLGLKEAKELVDGAPALVKEGVATAEAEEIKAKLEEAGASVTLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.84 | -1.83804997500709 | 2.7e-94 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.88 | -0.881039660602729 | 1.5e-22 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.82 | -0.819892781633142 | 9.6e-20 | 27678244 | |
Retrieved 3 of 1 entries in 1.4 ms
(Link to these results)