Bacterial taxon 373153
Protein WP_000024543.1
50S ribosomal protein L4
Streptococcus pneumoniae D39
Gene rplD, UniProt Q04MN5
>WP_000024543.1|Streptococcus pneumoniae D39|50S ribosomal protein L4
MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.21 | -2.21345706469231 | 9.2e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1 | -1.00165848223046 | 9.3e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.6 | -0.595608217132584 | 0.022 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)