Bacterial taxon 373153
Protein WP_001125943.1
50S ribosomal protein L35
Streptococcus pneumoniae D39
Gene rpmI, UniProt Q04KW8
>WP_001125943.1|Streptococcus pneumoniae D39|50S ribosomal protein L35
MPKQKTHRASAKRFKRTGSGGLKRFRAYTSHRFHGKTKKQRRHLRKASMVHSGDYKRIKAMLTRLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.54 | -2.54213061483574 | 6.5e-112 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.32 | -1.32043403012255 | 4.6e-31 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.13 | -1.12754894131717 | 4.9e-23 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)