Bacterial taxon 373153
Protein WP_001265622.1
50S ribosomal protein L33
Streptococcus pneumoniae D39
Gene rpmG, UniProt Q04I36
>WP_001265622.1|Streptococcus pneumoniae D39|50S ribosomal protein L33
MRVNITLEHKESGERLYLTSKNKRNTPDRLQLKKYSPKLRKHVVFTEVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.57 | -1.56939369119819 | 2.9e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.98 | -0.976083022353525 | 0.00072 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.88 | -0.879680095860695 | 0.0023 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)