Bacterial taxon 373153
Protein WP_000916509.1
50S ribosomal protein L27
Streptococcus pneumoniae D39
Gene rpmA, UniProt Q04KI2
>WP_000916509.1|Streptococcus pneumoniae D39|50S ribosomal protein L27
MLKMTLNNLQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVTGGSILYRQRGTHIYPGVNVGRGGDDTLFAKVEGVVRFERKGRDKKQVSVYPIAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.33 | -1.32714071663703 | 1.5e-44 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.04 | -1.03529557316078 | 1.8e-27 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.75 | -0.746894142185462 | 5.8e-15 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)