Bacterial taxon 373153
Protein WP_000497691.1
50S ribosomal protein L24
Streptococcus pneumoniae D39
Gene rplX, UniProt Q04MM5
>WP_000497691.1|Streptococcus pneumoniae D39|50S ribosomal protein L24
MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQRPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.18 | -2.17683608751855 | 1.7e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.92 | -0.924197165921646 | 0.0083 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.9 | -0.902698876006541 | 0.01 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)