Bacterial taxon 373153
Protein WP_001055347.1
50S ribosomal protein L23
Streptococcus pneumoniae D39
Gene rplW, UniProt Q04MN4
>WP_001055347.1|Streptococcus pneumoniae D39|50S ribosomal protein L23
MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEAAFEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.17 | -2.1716365004689 | 3.7e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.94 | -0.943192617360199 | 0.00036 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.65 | -0.65341418409157 | 0.014 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)