Bacterial taxon 373153
Protein WP_000818137.1
50S ribosomal protein L22
Streptococcus pneumoniae D39
Gene rplV, UniProt Q04MN1
>WP_000818137.1|Streptococcus pneumoniae D39|50S ribosomal protein L22
MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.22 | -2.22238046350236 | 2.3e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.05 | -1.05195063481831 | 0.00042 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.95 | -0.948154309507932 | 0.0015 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)