Bacterial taxon 373153
Protein WP_000109141.1
50S ribosomal protein L21
Streptococcus pneumoniae D39
Gene rplU, UniProt Q04KI4
>WP_000109141.1|Streptococcus pneumoniae D39|50S ribosomal protein L21
MSTYAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEKQGKQKKVVTYKYKPKKGSHRKQGHRQPYTKVVINAINA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.37 | -1.37126228747992 | 7.1e-47 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.96 | -0.961342174475583 | 1.4e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.62 | -0.622248700965873 | 1.2e-10 | 27678244 | |
Retrieved 3 of 1 entries in 2.2 ms
(Link to these results)