Bacterial taxon 373153
Protein WP_000124836.1
50S ribosomal protein L20
Streptococcus pneumoniae D39
Gene rplT, UniProt Q04KW7
>WP_000124836.1|Streptococcus pneumoniae D39|50S ribosomal protein L20
MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKLWITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDAVAFTALADAAKAKLGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.57 | -2.57112528082349 | 1.1e-105 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.56 | -1.56448780043684 | 8.4e-40 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.37 | -1.36838096563569 | 8.3e-31 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)