Bacterial taxon 373153
Protein WP_001068668.1
50S ribosomal protein L19
Streptococcus pneumoniae D39
Gene rplS, UniProt Q04K32
>WP_001068668.1|Streptococcus pneumoniae D39|50S ribosomal protein L19
MNPLIQSLTEGQLRTDIPSFRPGDTVRVHAKVVEGNRERIQIFEGVVIARKGAGISENYTVRKISNGIGVERIFPIHTPRVEKIEVVRYGKVRRAKLYYLRALQGKAARIKEIRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.98 | -0.979323521898183 | 1.5e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.82 | -0.82219083084261 | 6.5e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.75 | -0.745046344422189 | 0.00029 | 27678244 | |
Retrieved 3 of 1 entries in 0.4 ms
(Link to these results)