Bacterial taxon 373153
Protein WP_000331493.1
50S ribosomal protein L17
Streptococcus pneumoniae D39
Gene rplQ, UniProt Q04ML0
>WP_000331493.1|Streptococcus pneumoniae D39|50S ribosomal protein L17
MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVEKMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNGGYTRILKTEPRRGDAAPMAIIELV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.81 | -1.80807191971513 | 5.7e-97 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.17 | -1.16972733858818 | 3.9e-41 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -1 | -0.997743495483711 | 2.4e-30 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)