Bacterial taxon 373153
Protein WP_000616545.1
50S ribosomal protein L14
Streptococcus pneumoniae D39
Gene rplN, UniProt Q04MM6
>WP_000616545.1|Streptococcus pneumoniae D39|50S ribosomal protein L14
MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVARELREGGFMKIVSLAPEVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.12 | -2.11935768069508 | 3.5e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.91 | -0.913320655960906 | 0.0054 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.86 | -0.857913123283717 | 0.0095 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)