Bacterial taxon 373153
Protein WP_001085809.1
50S ribosomal protein L11
Streptococcus pneumoniae D39
Gene rplK, UniProt Q04LP7
>WP_001085809.1|Streptococcus pneumoniae D39|50S ribosomal protein L11
MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFVTKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQVQEIAETKMPDLNAANVESAMRMIEGTARSMGFTVVD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.68 | -1.67648136663461 | 5.7e-56 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.23 | -1.23311626313832 | 1.0e-30 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.88 | -0.881176837775255 | 2.3e-16 | 27678244 | |
Retrieved 3 of 1 entries in 1.4 ms
(Link to these results)