Bacterial taxon 373153
Protein WP_000834308.1
5-formyltetrahydrofolate cyclo-ligase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMI8
>WP_000834308.1|Streptococcus pneumoniae D39|5-formyltetrahydrofolate cyclo-ligase
MKSELRKQVLHEMKAISQEQKQAIDQALTERLLHHPFYQEAKVIATYLSFSHEFQTRELIEQALKDGKKVLIPKTYPKGRMEFVAYDPQQLVKTSFALLEPQGDVEVVDASQIDLIHVPGLAFTTKGYRIGYGGGYYDRYLEHFSGRTLSTIYPCQIQDFIPENHDIPVQEVLIDEGNL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.55 | 1.54964050514929 | 2.8e-35 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.3 | 1.29781775098011 | 4.0e-25 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.24 | 1.23784830322417 | 3.8e-23 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)