Bacterial taxon 373153
Protein WP_000247133.1
30S ribosome-binding factor RbfA
Streptococcus pneumoniae D39
Gene rbfA, UniProt Q04LV9
>WP_000247133.1|Streptococcus pneumoniae D39|30S ribosome-binding factor RbfA
MVNHFRIDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNLDKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.14 | -1.14001300365582 | 2.4e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.87 | -0.874364805050502 | 3.1e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.73 | -0.734582454558883 | 2.8e-8 | 27678244 | |
Retrieved 3 of 1 entries in 2.1 ms
(Link to these results)